PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007304P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 261aa    MW: 29237.5 Da    PI: 8.8435
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007304P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.35e-3652107459
          zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                     ++lkcprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr++++
  MELO3C007304P1  52 EQLKCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKR 107
                     689***********************************************976655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.9E-3253106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.48454108IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-195499IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGLSSKQVSI DGFDWSKALM QAQKLELPKL APSSGVKRSQ HQNQNQIQPQ IEQLKCPRCD  60
STNTKFCYYN NYNKSQPRHF CRACKRHWTK GGTLRNVPVG GGRKNKRLKK KPTTNSKKSS  120
SSTAATAAAD LINPQMDVHH FQNLPLYQGL IFSPPSSSNW AECENFTTNY GILNSQNPDF  180
SAVSTTTSTH SPISPKFNNY SDQELKPTET EQPTHHPWQL PSTGCGIGDM SSSYWSWDDI  240
NTFTATDLNI PWDDEHDIKP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439887.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0A0KLF40.0A0A0A0KLF4_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.13e-25Dof family protein